Project name: Enterococcus faecium

Description: The PCR amplification of genomic DNA extracted from Enterococcus faecium TJUQ1 with primers targeting five known enterocin genes, which generated positive results only for enterocin B.The gene sequence showed 91% homology with E. faecium FSIS1608820 (GenBank number CP028727.1). The deduced amino acid sequence was RIKQHFIQRWSKCGAAIAGGLFGIPKGPLHGLLGLQMYTLNAT. No identical sequence was acquired from the database, while only 60% coverage with Enterocin B (Accession No. ADR70740.1). These results determined that enterocin TJUQ1 was a novel bacteriocin.

Data type: genome sequencing

Sample scope: Monoisolate

Last updated: 2019-11-22